PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011085123.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family LBD
Protein Properties Length: 172aa    MW: 18979.6 Da    PI: 8.0024
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011085123.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.45e-43111101100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrr+CakdCv+ap+fp+++p+kfa+vhk+FGasn++k+l++lp  +r da+sslvyeA ar+rdPvyG++g i+ lq+q++ql+ +la
  XP_011085123.1  11 PCASCKLLRRRCAKDCVFAPHFPSDHPHKFAIVHKVFGASNISKMLQELPLPQRADAVSSLVYEATARVRDPVYGCTGAISYLQSQVAQLQMQLA 105
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     l+++e
  XP_011085123.1 106 LAQAE 110
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.09610111IPR004883Lateral organ boundaries, LOB
PfamPF031952.0E-4211108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MGGSGTAGNS PCASCKLLRR RCAKDCVFAP HFPSDHPHKF AIVHKVFGAS NISKMLQELP  60
LPQRADAVSS LVYEATARVR DPVYGCTGAI SYLQSQVAQL QMQLALAQAE ILCNQIRQDQ  120
QLLPNTLQYL NETATQNNHM PQFHNFTSFD NKNVICSDSF KKDSVYGCDL VS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085123.11e-127PREDICTED: LOB domain-containing protein 12-like
SwissprotQ8LBW34e-66LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A067FN826e-74A0A067FN82_CITSI; Uncharacterized protein
TrEMBLV4TH276e-74V4TH27_9R
STRINGPOPTR_0008s07280.17e-73(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.16e-55LBD family protein